Protein coding transcript 35606

• Transcript: Ll_transcript_311327
• CDS coordinates: 348-1235 (+)
• Peptide sequence: MLLFQYLVIALEGDFLPRNATMNWNMQRESLLNMLLGSRKTIYKGLVKDCMKVICQLSQFQNELNKYAEFKKSSESQSPKYRQTALFLALPEVVKNTCVSMEKLLVMIMGLDFSKKKADIEGHTIRADGTRTPAMDIILDELAYSEDVVPLFLQIFTEPKWKLEIVVQYLWKYITKPSVRTRKTSGSTYDSTFHGALRCFSNKTGTKGIIKKMGADVVQFLLAHGFQAQLSILAEENRYDNHAGDQEGRANALSDLCQMFISAFDSLRSTNQHMEILPIGKEALFTAATVISMKS*
• ORF Type: complete

Annotations of Ll_transcript_311327

• Blastp: Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 46.18% of identity
• Blastx: Negative regulator of systemic acquired resistance SNI1 from Arabidopsis with 43.6% of identity
• Eggnog: NA(ENOG410XZEF)
• Kegg: Link to kegg annotations (AT4G18470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422773.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;