Protein coding transcript 36255

• Transcript: Ll_transcript_310679
• CDS coordinates: 1776-2237 (+)
• Peptide sequence: MHMVSLTFFICLWYREPRGFGFVQYLDPDDAADAKYQMDGQIFLGRELTVVFAEENRKKPAEMRARERGRSYDYRRSPRRYSRSPRYGQYSRSPDYSPSPRGRHYSRSISPRDRRYRGRSYSRSPYGSRSRSRSRSYRRGYSRSLSRSPGYSR*
• ORF Type: complete

Annotations of Ll_transcript_310679

• Blastp: Serine/arginine-rich SC35-like splicing factor SCL30A from Arabidopsis with 54.86% of identity
• Blastx: Serine/arginine-rich SC35-like splicing factor SCL30A from Arabidopsis with 75% of identity
• Eggnog: serine arginine-rich splicing factor(ENOG4111J16)
• Kegg: Link to kegg annotations (AT3G13570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428894.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;