Transcript | Ll_transcript_496308 |
---|---|
CDS coordinates | 2-340 (+) |
Peptide sequence | LCSHALKVLSLRNIVKIPDMYILNRWMKDAKSRSDKDICHNVIQEDPKAKMASWYTYLCRLHADLATKGAQKEVYKIGVNGLIKTMEAMDACLRGTCKGILMFNHQYLIKYLL |
ORF Type | internal |
Blastp | Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 34.94% of identity |
---|---|
Blastx | Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 34.94% of identity |
Eggnog | protein FAR1-RELATED SEQUENCE 3-like(ENOG410ZPZY) |
Kegg | Link to kegg annotations (AT2G27110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020216867.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer