| Transcript | Ll_transcript_496308 |
|---|---|
| CDS coordinates | 2-340 (+) |
| Peptide sequence | LCSHALKVLSLRNIVKIPDMYILNRWMKDAKSRSDKDICHNVIQEDPKAKMASWYTYLCRLHADLATKGAQKEVYKIGVNGLIKTMEAMDACLRGTCKGILMFNHQYLIKYLL |
| ORF Type | internal |
| Blastp | Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 34.94% of identity |
|---|---|
| Blastx | Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 34.94% of identity |
| Eggnog | protein FAR1-RELATED SEQUENCE 3-like(ENOG410ZPZY) |
| Kegg | Link to kegg annotations (AT2G27110) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020216867.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer