Transcript | Ll_transcript_500384 |
---|---|
CDS coordinates | 2-445 (+) |
Peptide sequence | AIGLSTVSAAWGIGLIIGPALGGYLAQPVEKYPHVFSKGSFWEKFPYSLPCFIISGLAFVAAIVCIWIPETLHNHNGGNESTDDDTEALENGSSGSCQDKIVQKNENLLRNWPLMAAILIYSIYALHDIAYQEVSFHVNEVKNGLCI* |
ORF Type | 5prime_partial |
Blastp | Protein ZINC INDUCED FACILITATOR 1 from Arabidopsis with 44.91% of identity |
---|---|
Blastx | Protein ZINC INDUCED FACILITATOR-LIKE 1 from Arabidopsis with 56.25% of identity |
Eggnog | Major Facilitator superfamily(ENOG410XSE0) |
Kegg | Link to kegg annotations (AT5G13740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447123.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer