Protein coding transcript 399

• Transcript: Ll_transcript_448718
• CDS coordinates: 2-358 (+)
• Peptide sequence: DKEDIKEEKTEDDEKKDGEEEKAKRKFMFNIADGGFTELHTLWQNEEKAAVPGREYEIWHRRHDYWLLGGIVTHGYGRWQDIQNDIRFAIINEPFKMDVGKGNFLEIKNKFLARRFKLL
• ORF Type: internal

Annotations of Ll_transcript_448718

• Blastp: Chromodomain-helicase-DNA-binding protein Mi-2 homolog from Sophophora with 95.96% of identity
• Blastx: Chromodomain-helicase-DNA-binding protein Mi-2 homolog from Sophophora with 97.85% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (Dmel_CG8103)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014632790.1)
• Pfam: CHDCT2 (NUC038) domain (PF08074.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;