| Transcript | Ll_transcript_438249 |
|---|---|
| CDS coordinates | 1-339 (+) |
| Peptide sequence | DVSLLSIQGGVFAVKATAGDTHLGGEDFDNTLLDHFKTEFKRKNKADISDDARAVRRLKSACERAKRTLSSVTQTTVEVDSLYQGIDFSANITRARFEEINAAAFKSTIDPVE |
| ORF Type | internal |
| Blastp | NAD-specific glutamate dehydrogenase from Achlya with 38.24% of identity |
|---|---|
| Blastx | Ribosome-associated molecular chaperone sks2 from Schizosaccharomyces with 80.36% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016172252.1) |
| Pfam | NAD-specific glutamate dehydrogenase (PF10712.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer