Protein coding transcript 42759

• Transcript: Ll_transcript_358787
• CDS coordinates: 109-888 (+)
• Peptide sequence: MTVTSWFLVASWFMAPFVFNPSGFDWLKTVYDFDDFMNWIWYKGSVFAKAEQSWERWWYEEQDHLKVTGLWGKLFEIILDLRFFFFQYGIVFHLGVAAESTSIAVYLLSWIFVFVAFGISVVIAYARNRYAAKEHILYRLVQFLVIILSILVIVVLLEFTSFKFVDLFTSLLAFIPTGWGLLSIAQVFRPFLQSSIIWNGVVSMARLYDTMFGVIVMAPVALLSWLPGVQNMQTKILFNEAFSRGLRISQIVTGKKSKA*
• ORF Type: complete

Annotations of Ll_transcript_358787

• Blastp: Callose synthase 12 from Arabidopsis with 70.95% of identity
• Blastx: Callose synthase 12 from Arabidopsis with 70.95% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT4G03550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449022.1)
• Pfam: 1,3-beta-glucan synthase component (PF02364.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;