Protein coding transcript 43

• Transcript: Ll_transcript_438241
• CDS coordinates: 2-382 (+)
• Peptide sequence: NTQPFKLVRAAAPYFRVKDGEPRNIVNISSTSGLHGNAGQANYALAKAGVTGLTKTIAKEWGPAFGVRANTVAFGHIATRLTAAKEEGAFITTPDGVKVALGIPQKQKAGREDGEAAFKDIPLGRPG
• ORF Type: internal

Annotations of Ll_transcript_438241

• Blastp: Estradiol 17-beta-dehydrogenase 8 from Homo with 51.32% of identity
• Blastx: Estradiol 17-beta-dehydrogenase 8 from Homo with 51.32% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (7923)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502323.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;