Protein coding transcript 4310

• Transcript: Ll_transcript_495889
• CDS coordinates: 474-920 (+)
• Peptide sequence: MRTFFQTPQSSQFVSSAGEAVAVAQEVVKTMLAKGYVLSKDALAKAKDFDESHQVSATATAKVSELSQRIGLADKIYAGVEAIKSVDQKYNVSETTKAAASATGRSVAAATNSVVNSSYFSKGVLWMSGALTRAAQAASDLGTRNGRQ*
• ORF Type: complete

Annotations of Ll_transcript_495889

• Blastp: Binding partner of ACD11 1 from Arabidopsis with 43.97% of identity
• Blastx: Binding partner of ACD11 1 from Arabidopsis with 46.22% of identity
• Eggnog: actin cytoskeleton protein(ENOG4111ICI)
• Kegg: Link to kegg annotations (AT5G16840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432056.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;