Transcript | Ll_transcript_438275 |
---|---|
CDS coordinates | 3-377 (+) |
Peptide sequence | MEELSEKESRKLGSQEVSNEFKTLINSQDLNTLNHLQHTVLGRLQDSNAVLTHFNDFSEHCFAEISGDITRNTRVLKSVKSDLDYIFQKLRSMKSKISATYPDAFPEHSVNEVTDRRPDLEMPK* |
ORF Type | complete |
Blastp | KxDL motif-containing protein 1 from Rattus with 32.11% of identity |
---|---|
Blastx | KxDL motif-containing protein 1 from Rattus with 32.11% of identity |
Eggnog | KxDL motif containing 1(ENOG4111UUW) |
Kegg | Link to kegg annotations (498606) |
CantataDB | Link to cantataDB annotations (CNT0001487) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444241.1) |
Pfam | Uncharacterized conserved protein (PF10241.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer