Protein coding transcript 469

• Transcript: Ll_transcript_307428
• CDS coordinates: 46-447 (+)
• Peptide sequence: MADPEKQPEQPKAVPQKPVIANKVTGVVKWFNVKSGYGFINRNDSKEDVFVHQSAIVKNNPKKAVRSVGDGEVVEFDVVVGEKGNEAANVTGPAGEPVKGSPYAADKRRGYRQWYYGGRGGRGMRPRREGYESG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_307428

• Blastp: Y-box factor homolog from Aplysia with 68% of identity
• Blastx: Y-box factor homolog from Aplysia with 68.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014500223.1)
• Pfam: 'Cold-shock' DNA-binding domain (PF00313.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;