Protein coding transcript 48

• Transcript: Ll_transcript_452968
• CDS coordinates: 23-388 (+)
• Peptide sequence: MQDLIIIVFMLSFASFYSCNARLLKAVPNKTIFNVMEYGAVGDSVTDDSQAFLKAWNDACGISDIGTFEVPNGKTFMLKPLSFNGPCISSEVNFKEILLHQVALKHGQGMWTRPNGLRLTM*
• ORF Type: complete

Annotations of Ll_transcript_452968

• Blastp: Probable polygalacturonase At3g15720 from Arabidopsis with 44% of identity
• Blastx: Probable polygalacturonase At3g15720 from Arabidopsis with 44% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: Link to kegg annotations (AT3G15720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418602.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;