Protein coding transcript 48725

• Transcript: Ll_transcript_422386
• CDS coordinates: 1219-2358 (+)
• Peptide sequence: MEAGLRQARAAIGQARLENQTHDSDYVPEGPMYWNAKAFHRSYLEMEKQFKIFVYEEGEPPVFHNGPCKSIYSMEGNFIHAMEMNDQFRTRDPEKAHVFFLPFSVVMMVRFVYIRDSRDFGPIRKTVIDYVNLVAGRYPYWNRSLGADHFMLACHDWGPETSLSVPNMYKNSIRALCNANTSEGFNPSKDVSFPEINLQTGTIDGFVGGPSASKRPVLAFFAGGLHGHIRSILLEHWENKDEDIQVHRYLPEGVSYYAMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPNLKEILTKISPRQYIRMQRRVGQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNFRIIDDQ*
• ORF Type: complete

Annotations of Ll_transcript_422386

• Blastp: Probable glycosyltransferase At5g03795 from Arabidopsis with 72.53% of identity
• Blastx: Probable glycosyltransferase At5g03795 from Arabidopsis with 66.05% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT5G03795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431437.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;