Protein coding transcript 49

• Transcript: Ll_transcript_452961
• CDS coordinates: 3-341 (+)
• Peptide sequence: NGLPLALCIIGSNLFGKSLKEWDSALDSYERGTNKSIHKILRVSYDNLEDNEKGIFLDIACFFQGERMECVINMLLHGRGFRPEYGIGVLMQKSLLRAEYGHVSMHDLIEEMG
• ORF Type: internal

Annotations of Ll_transcript_452961

• Blastp: Probable WRKY transcription factor 16 from Arabidopsis with 44.74% of identity
• Blastx: Probable WRKY transcription factor 16 from Arabidopsis with 44.74% of identity
• Eggnog: Transcription factor. Interacts specifically with the W box (5'-(T)TGAC CT -3'), a frequently occurring elicitor- responsive cis-acting element(ENOG410ZRAD)
• Kegg: Link to kegg annotations (AT5G45050)
• CantataDB: -
• Mirbase: mtr-MIR2609b (MI0011863)
• Ncbi protein: Link to NCBI protein (XP_020991468.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;