| Transcript | Ll_transcript_509433 |
|---|---|
| CDS coordinates | 2503-2868 (+) |
| Peptide sequence | MNSMREHAELLTSVRDDISEYKTSGTTSPRMQLLRERANIHGSISHIDDVISQAQATRAVLGSQRALFGDVQGKVKVLSDKFPIIRSLLGSIRRKRSRDTLILSAVIAACTLFLIIYWLSK* |
| ORF Type | complete |
| Blastp | Golgi SNAP receptor complex member 1-2 from Arabidopsis with 71.09% of identity |
|---|---|
| Blastx | Golgi SNAP receptor complex member 1-2 from Arabidopsis with 85.38% of identity |
| Eggnog | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor (By similarity)(ENOG410YI1X) |
| Kegg | Link to kegg annotations (AT2G45200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460704.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer