Protein coding transcript 54

• Transcript: Ll_transcript_283824
• CDS coordinates: 2-316 (+)
• Peptide sequence: AESIRNAKKDLLAAVHPDMAKDSSANQTGLYELRGVVTHQGSSADSGHYTAYVKKTALPGQEEDGKWWWFNDDKVSEVDADKIPTLAGGGESHSALILLYRAIPL
• ORF Type: internal

Annotations of Ll_transcript_283824

• Blastp: Ubiquitin carboxyl-terminal hydrolase 6 from Schizosaccharomyces with 52.27% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 6 from Schizosaccharomyces with 52.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC6G9.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015938622.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF13423.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;