| Transcript | Ll_transcript_440221 |
|---|---|
| CDS coordinates | 2236-2589 (+) |
| Peptide sequence | MQLVFGVFTGEAWGYLGSRRFLLELDMHSDAVHGLDSSLFETVIEIGSVGKGFSQGVNNFFAHSKGDSSATNQTMAALKRAQETLRTENIKITSASASNPGIPPSSLMVFSKKVLIS* |
| ORF Type | complete |
| Blastp | Nicastrin from Arabidopsis with 61.6% of identity |
|---|---|
| Blastx | Nicastrin from Arabidopsis with 59.55% of identity |
| Eggnog | nicastrin(ENOG410XT6X) |
| Kegg | Link to kegg annotations (AT3G52640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419602.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer