Protein coding transcript 55093

• Transcript: Ll_transcript_440223
• CDS coordinates: 2236-3369 (+)
• Peptide sequence: MQLVFGVFTGEAWGYLGSRRFLLELDMHSDAVHGLDSSLFETVIEIGSVGKGFSQGVNNFFAHSKGDSSATNQTMAALKRAQETLRTENIKITSASASNPGIPPSSLMVFSKKNPAISGVVLEDFDSVFVNKFYHSHLDDLSNVNSSAVVAAASLVARTLYILASETKDVQDSALTSINVNVSLVEQLMGCLLGCDPGLSCELVKKYISPASTCPGHYVGVIQDEPSSTPYSGYINDVPRFIWNFLADRTSISREHNGSSNCQNGCNGRDEVCIKAEIDGKGACVLSTTRYVPAYSTRLKFESGVWTVLPANSSDSMGAVDPVWTESNWNSISMRIYTIQVAAYDRLVLFVGVILTVLAYLAVTVTRALAIKAMKRD*
• ORF Type: complete

Annotations of Ll_transcript_440223

• Blastp: Nicastrin from Arabidopsis with 64.99% of identity
• Blastx: Nicastrin from Arabidopsis with 64.36% of identity
• Eggnog: nicastrin(ENOG410XT6X)
• Kegg: Link to kegg annotations (AT3G52640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419602.1)
• Pfam: Nicastrin (PF05450.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;