Transcript | Ll_transcript_440228 |
---|---|
CDS coordinates | 2236-2589 (+) |
Peptide sequence | MQLVFGVFTGEAWGYLGSRRFLLELDMHSDAVHGLDSSLFETVIEIGSVGKGFSQGVNNFFAHSKGDSSATNQTMAALKRAQETLRTENIKITSASASNPGIPPSSLMVFSKKVLIS* |
ORF Type | complete |
Blastp | Nicastrin from Arabidopsis with 66.96% of identity |
---|---|
Blastx | Nicastrin from Arabidopsis with 63.02% of identity |
Eggnog | nicastrin(ENOG410XT6X) |
Kegg | Link to kegg annotations (AT3G52640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419602.1) |
Pfam | Nicastrin (PF05450.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer