Protein coding transcript 59485

• Transcript: Ll_transcript_369956
• CDS coordinates: 1651-2223 (+)
• Peptide sequence: MYVCNDIFNQIMSIAGNINYYDIRKKCEGDLCYDFSNVEKFLNKKTVRDALGVGDLDFVSCSSTVYDAMMQDWMRNLEVGIPALLEDGIKVLVYAGEEDLICNWLGNSRWVHAMEWSGRKEFGASPTVPFLVDGAEAGELKSHGPLTFLKVNEAGHMVPMDQPKAALQMLRSWTQGKLAMTRSGDNVSAN*
• ORF Type: complete

Annotations of Ll_transcript_369956

• Blastp: Serine carboxypeptidase-like 48 from Arabidopsis with 75.71% of identity
• Blastx: Serine carboxypeptidase 3 from Oryza sativa with 72.92% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G45010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447818.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;