Protein coding transcript 59488

• Transcript: Ll_transcript_369964
• CDS coordinates: 2211-2579 (+)
• Peptide sequence: MMQDWMRNLEVGIPALLEDGIKVLVYAGEEDLICNWLGNSRWVHAMEWSGRKEFGASPTVPFLVDGAEAGELKSHGPLTFLKVNEAGHMVPMDQPKAALQMLRSWTQGKLAMTRSGDNVSAN*
• ORF Type: complete

Annotations of Ll_transcript_369964

• Blastp: Serine carboxypeptidase-like from Pisum with 72.65% of identity
• Blastx: Serine carboxypeptidase-like 48 from Arabidopsis with 75.31% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447818.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;