Transcript | Ll_transcript_283829 |
---|---|
CDS coordinates | 79-666 (+) |
Peptide sequence | MDNLRFNSASSNVKDYYEVSESRKQVLDHIMEALIAPNINMIGVCGKDDDNIASLLQRVIRRGWRDNLFGMIVMIRIGENPDIRRIQEEIAHEIGCSFQRQVKQDKKTRCCGFNYFEFHSANTKKFDTENAQQLFDKIRSVPKIMFILRDVRSRLDLGKVGIPFGVDHQGCKLIFISESDDILSNHMNAQCTFIF* |
ORF Type | complete |
Blastp | Probable disease resistance protein At5g47260 from Arabidopsis with 20.99% of identity |
---|---|
Blastx | Probable disease resistance protein At5g47260 from Arabidopsis with 20.99% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT5G47260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003532765.2) |
Pfam | NB-ARC domain (PF00931.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer