Protein coding transcript 62198

• Transcript: Ll_transcript_284828
• CDS coordinates: 1171-1905 (+)
• Peptide sequence: MEIYPVLDELALSISTINLERVRRFKGHLLALTQRVQKVRDEIEHLMDDDGDMAEMCLTEKRMRSDSYPLNDYLQTISSGSGRVISRSAPASPEQSTSGLQMLQRAFSSIGNSSKHDSSVRSSDNGERIEPLEMLLEAYFIVIDNTLNTLSSLKEYIDDTEDFINIKLGNIQNRLIQFEVLLTAATLVAAVFTVVAGVFGMNFKAPVFNYPFGFHWVLVITGIACASLYIAFLYYFRYKNVLPS*
• ORF Type: complete

Annotations of Ll_transcript_284828

• Blastp: Magnesium transporter MRS2-B from Oryza sativa with 58.37% of identity
• Blastx: Probable inactive purple acid phosphatase 1 from Arabidopsis with 66.46% of identity
• Eggnog: Magnesium transporter(ENOG410XNNZ)
• Kegg: Link to kegg annotations (4341687)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461931.1)
• Pfam: CorA-like Mg2+ transporter protein (PF01544.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;