Protein coding transcript 66363

• Transcript: Ll_transcript_329984
• CDS coordinates: 161-685 (+)
• Peptide sequence: MGDTNDALNLGLSLRLGAPQNTNNNDNNDNNFMHQSLPNHTLSFNAFFHFPDRTSETRSFLRGIDVNAAPPPSLTAATGGDEENGVSSPNSTVSSISGKRSEREGNGDETNAAERATCSEGGGSDEDDGGGDGDGDGDAENSRKKLRLSKEQALVLEETFKEHNTLNPVSYSGI*
• ORF Type: complete

Annotations of Ll_transcript_329984

• Blastp: Homeobox-leucine zipper protein HAT3 from Arabidopsis with 56.67% of identity
• Blastx: Homeobox-leucine zipper protein HAT3 from Arabidopsis with 90.91% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT3G60390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464444.1)
• Pfam: HD-ZIP protein N terminus (PF04618.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;