Protein coding transcript 67

• Transcript: Ll_transcript_321968
• CDS coordinates: 25-387 (+)
• Peptide sequence: MDFTSGKIIFNKFKSVVSYQVSDLPLFSLDSVSKAPKITTYDSLDDDVIKSYMEFSLASMLYYAMKEGACSEQSSRMTAMDNASKNAGEMIEKLTLTFNRTRQAVITRELIEIISGASAL*
• ORF Type: complete

Annotations of Ll_transcript_321968

• Blastp: ATP synthase subunit gamma, mitochondrial from Sophophora with 73.85% of identity
• Blastx: ATP synthase subunit gamma, mitochondrial from Sophophora with 73.85% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex (By similarity)(COG0224)
• Kegg: Link to kegg annotations (Dmel_CG7610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014496317.1)
• Pfam: ATP synthase (PF00231.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;