Protein coding transcript 69928

• Transcript: Ll_transcript_465814
• CDS coordinates: 135-974 (+)
• Peptide sequence: MGNVNDREEDFDVITPSHLQQNEEQEECESVVPSEFMAHDPPASPRATHSPFIFTPQVPVVPLQRPDEMHVPSPTWMQTSSGYEDMYSELGIPTMITWSYGGKEVAVEGSWDNWKTRIPLQRSGKDFTIMKVLPSGVYQFRFVVDGQWRYAPDLPWAQDEAGNAYNILDLQDSVPEDIGSISSFEPPKSPESTYNNLQLSSEDYAKEPPLVPPYLQMTLLNVPSTNIEIQPPISRPQHVMLNHLYMQKEKGSPSVVALGTTHRFLAKYVTVVLYKSLQR*
• ORF Type: complete

Annotations of Ll_transcript_465814

• Blastp: SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 67.01% of identity
• Blastx: SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 67.01% of identity
• Eggnog: Protein kinase, AMP-activated, beta(ENOG410XRB3)
• Kegg: Link to kegg annotations (AT4G16360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440006.1)
• Pfam: Glycogen recognition site of AMP-activated protein kinase (PF16561.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;