Protein coding transcript 70

• Transcript: Ll_transcript_335793
• CDS coordinates: 2-328 (+)
• Peptide sequence: NGRAKYSHGRYPVLDVSFQDAHHCFSGGLDNMLKAYDLNVGKETIIGSHTNAIKVVECSHEHGCVLTGGWDNDVKMWDPRSGRCTGNFLQPNKVYTIGLCGEKFVVGTA
• ORF Type: internal

Annotations of Ll_transcript_335793

• Blastp: Mitotic checkpoint protein BUB3 from Xenopus with 48.6% of identity
• Blastx: Mitotic checkpoint protein BUB3 from Xenopus with 48.6% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (399106)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003610622.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;