Protein coding transcript 71

• Transcript: Ll_transcript_335780
• CDS coordinates: 1-456 (+)
• Peptide sequence: KDGKVLVQGINSTGLMVSNSKIFIQSPNANGNLISNDNISVSCNGETCSSSTKIRDVVGRETKYVVGVAQNGPGSINLSHFKEKGLTLLVVMMVTIFIAMFSFLYLNITTTRREMQLCASLIKQIEATQQAERKNMNKSLAFASASHDVRTS
• ORF Type: internal

Annotations of Ll_transcript_335780

• Blastp: Histidine kinase CKI1 from Arabidopsis with 37.72% of identity
• Blastx: Histidine kinase CKI1 from Arabidopsis with 37.72% of identity
• Eggnog: Histidine kinase(ENOG410XT1K)
• Kegg: Link to kegg annotations (AT2G47430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439027.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;