Protein coding transcript 71677

• Transcript: Ll_transcript_482623
• CDS coordinates: 554-1996 (+)
• Peptide sequence: MGSCFSVESRSPHPSYRKNSNNKHGSHTSSIQYWKNEPLHRLPSRIFLNASTQFASLFTQQGKKGTNQDAMLLWENFCSRQDTTFCGVFDGHGPYGHMVAKRVRDSLPLKLNAHWEHCVSGDEVLKEITVNAAGSMNSEEAAIVSADEESRTSIDAEESTKHPEIFQTLKQSFLKAFKVMDRELKTHQSIDCFCSGTTAVTLVKQGRHLIIGNVGDSRAVMGTRAKDDSIVAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNNDSPGLAMARAFGDFCLKDFGLISVPDVSYRQLTKSDEFVVLATDGIWDVLSNKEVVDIVAAAPSRSSAARAVVESAVRAWRYKYPTSKVDDCAVVCLFLDSDLHPMSSASNAKSNERPISADQVSSPGGAVSGPTILKGSATCRASNDTSLGESNDEVSKEEEIDAESEKDWSALEGVSRVNTLLNLPRFVPDKDDKAAAGMRKRK*
• ORF Type: complete

Annotations of Ll_transcript_482623

• Blastp: Probable protein phosphatase 2C 33 from Arabidopsis with 64.23% of identity
• Blastx: Probable protein phosphatase 2C 33 from Arabidopsis with 64.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G02750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431642.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;