Protein coding transcript 71920

• Transcript: Ll_transcript_352828
• CDS coordinates: 111-539 (+)
• Peptide sequence: MQNMKRKREGEAGMDIVWQTPANPPHPQDYIFRNGTRYVKPYYFEFIAHVKNRWAGKTIVDLFADEFKGRPYEYYVSAVKCGRIQVDGGMVPVSYMVKSSQKISHFVHRHEPPVMACVVPILQKEPDVLTVCKPASVPVSKH*
• ORF Type: complete

Annotations of Ll_transcript_352828

• Blastp: RNA pseudouridine synthase 7 from Oryza sativa with 76.92% of identity
• Blastx: RNA pseudouridine synthase 7 from Oryza sativa with 76.92% of identity
• Eggnog: pseudouridine synthase activity(COG0564)
• Kegg: Link to kegg annotations (9269812)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417834.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;