Protein coding transcript 72

• Transcript: Ll_transcript_335806
• CDS coordinates: 3-560 (+)
• Peptide sequence: NPKISDFGMARLFVLDQTQGNTSRIVGTYGYMAPEYVTQGKFSVKSDVFSFGVLALEIVCGQKNSGFRDGEHVEDLLSFAWKKWKDGTASNLIDPTMSNGSSNEIMRCIHIGLLCVQENLSDRPTMASVVLMLNSYSTTLPVPLEPAFFMQSRGMSNIQSWEYNSEATESTKSVKAFSSEVLITR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_335806

• Blastp: Cysteine-rich receptor-like protein kinase 8 from Arabidopsis with 55.14% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 8 from Arabidopsis with 55.14% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23160)
• CantataDB: Link to cantataDB annotations (CNT0002981)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427246.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;