| Transcript | Ll_transcript_393869 |
|---|---|
| CDS coordinates | 22-333 (+) |
| Peptide sequence | MDKASVLGDAIKYLKQMQEKVSSLEEEQNRKKTIESVVFVKKSILSNSDDLDTGGSFDEALPEIEARVWERNVLIRVHCEKKKGVIEKTISEIEKLHLKVINTS |
| ORF Type | 3prime_partial |
| Blastp | Transcription factor bHLH25 from Arabidopsis with 49.55% of identity |
|---|---|
| Blastx | Transcription factor bHLH25 from Arabidopsis with 49.11% of identity |
| Eggnog | Transcription factor(ENOG410YG6S) |
| Kegg | Link to kegg annotations (AT4G37850) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440322.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer