Transcript | Ll_transcript_393869 |
---|---|
CDS coordinates | 22-333 (+) |
Peptide sequence | MDKASVLGDAIKYLKQMQEKVSSLEEEQNRKKTIESVVFVKKSILSNSDDLDTGGSFDEALPEIEARVWERNVLIRVHCEKKKGVIEKTISEIEKLHLKVINTS |
ORF Type | 3prime_partial |
Blastp | Transcription factor bHLH25 from Arabidopsis with 49.55% of identity |
---|---|
Blastx | Transcription factor bHLH25 from Arabidopsis with 49.11% of identity |
Eggnog | Transcription factor(ENOG410YG6S) |
Kegg | Link to kegg annotations (AT4G37850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440322.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer