Protein coding transcript 733

• Transcript: Ll_transcript_432181
• CDS coordinates: 73-432 (+)
• Peptide sequence: MSQFSLNDLLGRLGKSPKGVNTGITLLAMAGASAYGISQSMYTVDGGHRAIIFSRLGGVQKEVYAEGLHFRIPWFHYPIIYDIRSRPRKISSPTGSKDLQMVNISLRVLSRPDAATLPVM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_432181

• Blastp: Prohibitin-2 from Bos with 70.25% of identity
• Blastx: Prohibitin-2 from Bos with 70.25% of identity
• Eggnog: Band 7 protein(COG0330)
• Kegg: Link to kegg annotations (515363)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017423143.1)
• Pfam: SPFH domain / Band 7 family (PF01145.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;