Protein coding transcript 736

• Transcript: Ll_transcript_307977
• CDS coordinates: 136-1260 (+)
• Peptide sequence: MVSTNEPIQIFFFPFVGGGHQIPMIDTARVFASHGSISTIITTPSNSIHFKNLITRDQQNGLNITIHTLTLPHNSVDIIDMFSGPMTDTSNLLEPLKQLLLLQQPDCIVVDMFHRWAGEVMDDLGIKMIVFTGNGCFPRCVHENIRKHVQLENISSDYEPFIVPNLPDRIEMTKSQLPIFLRDHSVFPDRLKAFKQLEEKSFGTIINSFYDLEPAYADYVRKELGQKAWIVGPVSLCNRSKEDKTERGKVSTIDEKSCLNWLNSKKANSVLYVSFGSLASLPHEQLKEIAYGLEASDHSFIWVVGKTFNSSKIEESGSANFLLDGFEERMKENEKGLIIRDWAPQLLILEHVAVGGFLTHCGWNSTLEAVSSGVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_307977

• Blastp: Abscisate beta-glucosyltransferase from Vigna with 66.22% of identity
• Blastx: Abscisate beta-glucosyltransferase from Vigna with 66.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAB83692)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422174.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;