Protein coding transcript 74

• Transcript: Ll_transcript_451603
• CDS coordinates: 252-929 (+)
• Peptide sequence: MEEPEYMIWMKRKQILKSHIQAPIVIGACNNNNTNSWEERAFAEDAKRILGGCIWPPRSYSCNFCKRDFRSAQALGGHMNVHRRDRARLRQGLSPYHQNKEALHHFHHCQKIHPKLLSNSQSSSVNAREETFNDLGCIDYVETSLSMGFNSVFGQKSSPNGSCDEEATSYKRPKISIPSMPFFIKPCSKDRSLALKSAEEFVLVLKPGMEDLDLELRLGESQKKL*
• ORF Type: complete

Annotations of Ll_transcript_451603

• Blastp: Probable transcriptional regulator RABBIT EARS from Arabidopsis with 35.27% of identity
• Blastx: Probable transcriptional regulator RABBIT EARS from Arabidopsis with 35.54% of identity
• Eggnog: transcriptional regulator RABBIT EARS(ENOG410YQ0K)
• Kegg: Link to kegg annotations (AT5G06070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418740.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;