Protein coding transcript 77

• Transcript: Ll_transcript_451613
• CDS coordinates: 2-607 (+)
• Peptide sequence: FFFFGSPFNYTTISEMIGGAYEGLIVTKPIPEKSHDFLHCEDGKSTLKDRKGVRLCKKIKNQLVEYNSLPSYLKDNEYILGYYRSEWSLKHTLLSIFSIHNETLNVWTHLIGFFLFLFLTIYTAMKAPTVVDFNSLQHLPKMIGNADLNTIRLQLLNCLPSLPNIPDLLNFKNQLSTSLYSLDFSSLSGWNVVELLTNCLPE
• ORF Type: internal

Annotations of Ll_transcript_451613

• Blastp: Heptahelical transmembrane protein ADIPOR3 from Oryza sativa with 55.77% of identity
• Blastx: Heptahelical transmembrane protein ADIPOR3 from Oryza sativa with 55.77% of identity
• Eggnog: Channel protein (Hemolysin III family(COG1272)
• Kegg: Link to kegg annotations (4332161)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437892.1)
• Pfam: Haemolysin-III related (PF03006.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;