Protein coding transcript 77896

• Transcript: Ll_transcript_454856
• CDS coordinates: 1-306 (+)
• Peptide sequence: AYRKMPFGLCNAPTTFQRCILAIFADLVEKCIEVFMDDFSVFGDSFDGCLKNLERILKRYEKTNLILNWEKCHFMVTEGIVLGHKISAKELEVDRAKIEVI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_454856

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 41% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon opus from Sophophora with 39.3% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014622146.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;