Transcript | Ll_transcript_321647 |
---|---|
CDS coordinates | 22-357 (+) |
Peptide sequence | MDKIVRLWDLDTKTCLKMFAHNDYVTCIQFNPIDDDYFISGSLDAKVRIWNIPERHVVDWTDTHEMVTAVSYSPDGQCALVGTHKGGCRTYSTEDCKLSQTGTIEIRHKKKS |
ORF Type | 3prime_partial |
Blastp | Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 43.75% of identity |
---|---|
Blastx | Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 45.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC3H5.08c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448589.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer