Protein coding transcript 783

• Transcript: Ll_transcript_321647
• CDS coordinates: 22-357 (+)
• Peptide sequence: MDKIVRLWDLDTKTCLKMFAHNDYVTCIQFNPIDDDYFISGSLDAKVRIWNIPERHVVDWTDTHEMVTAVSYSPDGQCALVGTHKGGCRTYSTEDCKLSQTGTIEIRHKKKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_321647

• Blastp: Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 43.75% of identity
• Blastx: Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 45.76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC3H5.08c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448589.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;