Protein coding transcript 78573

• Transcript: Ll_transcript_341200
• CDS coordinates: 2196-2528 (+)
• Peptide sequence: MSKNLGLKEDDLIKAFGGENEVGGCLRVNFYPKCPQPDLTLGLSSHSDPGGMTIILPDDFVSGLQVYRGNEWVTVKPVPNAFIINIGDQIQVMSNAIYKSVEHRVIVNSNE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_341200

• Blastp: Probable 2-oxoglutarate-dependent dioxygenase At5g05600 from Arabidopsis with 71.17% of identity
• Blastx: Probable 2-oxoglutarate-dependent dioxygenase At5g05600 from Arabidopsis with 68.94% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT5G05600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413119.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;