| Transcript | Ll_transcript_425562 |
|---|---|
| CDS coordinates | 43-408 (+) |
| Peptide sequence | MATDTKFQGWLGKDEESVKGKMEWGQFEPKKWTEDDVDIEISHCGICGSDLHMLKSGWGPTPYPCVVGHEIIGKAVKVGKNVKHVKQGDRVGVGAQARSCLQPDCPDCSNGIENHCHRETVN |
| ORF Type | 3prime_partial |
| Blastp | - |
|---|---|
| Blastx | Cinnamyl alcohol dehydrogenase 2 from Arabidopsis with 43.97% of identity |
| Eggnog | alcohol dehydrogenase(COG1064) |
| Kegg | Link to kegg annotations (AT2G21730) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004503979.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer