Transcript | Ll_transcript_425554 |
---|---|
CDS coordinates | 27-368 (+) |
Peptide sequence | MATSQIISKRRKFVADGVFYAELSEFFSRTLSSEGYSGCEVRVTHQRTEVIIRATHTQEVLGEKGRRIRELTSLVQKRFRFPEGSVELYAEKVQNRGLDAVAQCESLRYKLLGG |
ORF Type | 3prime_partial |
Blastp | 40S ribosomal protein S3 from Schizosaccharomyces with 80.7% of identity |
---|---|
Blastx | 40S ribosomal protein S3 from Schizosaccharomyces with 80.7% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC16G5.14c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004501017.1) |
Pfam | KH domain (PF07650.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer