Protein coding transcript 8

• Transcript: Ll_transcript_534379
• CDS coordinates: 1-426 (+)
• Peptide sequence: TMSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLCVIAVNGLRGRLNRLPAAGSGDMIVATVKKGKPELRKKVMPAVVIRQRKPFRRKDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_534379

• Blastp: 60S ribosomal protein L23 from Sophophora with 93.57% of identity
• Blastx: 60S ribosomal protein L23 from Stegomyia with 93.89% of identity
• Eggnog: Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome (By similarity)(COG0093)
• Kegg: Link to kegg annotations (Dmel_CG3661)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003625359.2)
• Pfam: Ribosomal protein L14p/L23e (PF00238.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;