| Transcript | Ll_transcript_523207 |
|---|---|
| CDS coordinates | 1-297 (+) |
| Peptide sequence | QKGKSEFWRRKMRTFHSILDINKDGVISFDDFRILVDRFVYLGHLNPHHQKEFNEVVQSMWEERWGTISPYNLVTTEQYLEDMFHIVNDKQLRKKVHSF |
| ORF Type | internal |
| Blastp | Sarcoplasmic calcium-binding protein from Perinereis with 23.4% of identity |
|---|---|
| Blastx | Sarcoplasmic calcium-binding protein from Perinereis with 23.4% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003612619.2) |
| Pfam | EF hand (PF13202.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer