Protein coding transcript 847

• Transcript: Ll_transcript_334360
• CDS coordinates: 83-598 (+)
• Peptide sequence: MAYPCSNMALGCFLLLSVIVSSLSTISYAHFRFPDEEDTYSNKHFAFGDVTDQVVGDGSFAPQPQPENFGVYPPTTLPEFADLVPQPEPENFGADPPRVGNDFNETEIVSNERLKNAYVALQALKESIYSDPFNTTGNWVGEDVCSYNGVFCAEALDDPKLNVVAGIDLNDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_334360

• Blastp: Pollen-specific leucine-rich repeat extensin-like protein 2 from Arabidopsis with 74.19% of identity
• Blastx: Pollen-specific leucine-rich repeat extensin-like protein 2 from Arabidopsis with 74.19% of identity
• Eggnog: leucine-rich repeat extensin-like protein(ENOG410Y973)
• Kegg: Link to kegg annotations (AT1G49490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459399.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;