Transcript | Ll_transcript_334360 |
---|---|
CDS coordinates | 83-598 (+) |
Peptide sequence | MAYPCSNMALGCFLLLSVIVSSLSTISYAHFRFPDEEDTYSNKHFAFGDVTDQVVGDGSFAPQPQPENFGVYPPTTLPEFADLVPQPEPENFGADPPRVGNDFNETEIVSNERLKNAYVALQALKESIYSDPFNTTGNWVGEDVCSYNGVFCAEALDDPKLNVVAGIDLNDA |
ORF Type | 3prime_partial |
Blastp | Pollen-specific leucine-rich repeat extensin-like protein 2 from Arabidopsis with 74.19% of identity |
---|---|
Blastx | Pollen-specific leucine-rich repeat extensin-like protein 2 from Arabidopsis with 74.19% of identity |
Eggnog | leucine-rich repeat extensin-like protein(ENOG410Y973) |
Kegg | Link to kegg annotations (AT1G49490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459399.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer