Protein coding transcript 91

• Transcript: Ll_transcript_523368
• CDS coordinates: 3-470 (+)
• Peptide sequence: WLFFPFHRWYLYFYEKILASLIVDLDPDFTIPFWNWDNPKGMTIPSFYAEFDSPLYDTLRDPNSQPPKLINLNYSSDGEIPVDKTITPEEQVLSNLRVMYTQLVSGSKTPSLFFGCAFRACDTENPGQGSVESSPHGPVHVWTGRPWGGESHGEDM
• ORF Type: internal

Annotations of Ll_transcript_523368

• Blastp: Aureusidin synthase from Antirrhinum with 53.5% of identity
• Blastx: Aureusidin synthase from Antirrhinum with 53.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAB20048)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425637.1)
• Pfam: Common central domain of tyrosinase (PF00264.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;