Transcript | Ll_transcript_403784 |
---|---|
CDS coordinates | 1601-2296 (+) |
Peptide sequence | MEYEEVDRDNGHSYGNLCYTLKKLCMWEKKLYHEVKAEEKLRILHQKKCSQLKRMNKKGADAQKVEAVQTLIGILATKMKISIQVVDKISITISKLREEELWPQMNKFIHMFHKMWEDMQECYKCQYKEIAELKALDASTFNRKLSNDQIDAAIKLKSELQNWNLSLSDWIHAQISHVKALNGWLVRCLMYEPEEVPDDSTPFSPGKIGAPPVFVICNKWSRLVDNISEKNV |
ORF Type | 3prime_partial |
Blastp | Nitrate regulatory gene2 protein from Arabidopsis with 29.28% of identity |
---|---|
Blastx | Nitrate regulatory gene2 protein from Arabidopsis with 29.28% of identity |
Eggnog | Protein of unknown function (DUF632)(ENOG410YACB) |
Kegg | Link to kegg annotations (AT3G60320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438088.1) |
Pfam | Protein of unknown function (DUF632) (PF04782.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer