Protein coding transcript 913

• Transcript: Ll_transcript_290394
• CDS coordinates: 51-530 (+)
• Peptide sequence: MSANGSGGPVGDEKINTDIITLTRHLNEEQTKHSEATGDFTLLCHALQFSFKSIAYYIRRASLINLSGLAGATNSTGDDQKKLDVIGNDIFISAMRSSGRVRILVSEEEDELIEFPAGPNAKYAVACDPIDGSSNLDAGVSVGTIFGIYRLAESAEGKKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_290394

• Blastp: Fructose-1,6-bisphosphatase from Saccharomyces with 60.53% of identity
• Blastx: Fructose-1,6-bisphosphatase from Saccharomyces with 60.53% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YLR377C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004516643.1)
• Pfam: Fructose-1-6-bisphosphatase, N-terminal domain (PF00316.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;