Protein coding transcript 93

• Transcript: Ll_transcript_523363
• CDS coordinates: 229-1131 (+)
• Peptide sequence: MRNRVSNPLTLIFLLISLTLFSKSNAGGIVTYWGQDSREGSLTDTCNTGLYSIINIAFLSKFGGGRRPEINLAGHCNPGSCQKVGQGIKNCQNKGVKVFLSIGGDPSGNTYTLTSADDARKVADYIWDNFLGGQSGSRPFGDAVLDGVDFDIEGGEIHYAALARKLHEHASSSNRKFYLAAAPQCPFQNNILSGALNTALFDYVWIQFYNNGQANCEFNSNNQNGFRNSWNKWTSSISASKFFVGLPAAHAAATSGYVPSQDLINQLLPIVKSPKYGGIMLWNRYFDTLTGYSSKIKNSV*
• ORF Type: complete

Annotations of Ll_transcript_523363

• Blastp: Basic endochitinase from Nicotiana with 60.64% of identity
• Blastx: Basic endochitinase from Nicotiana with 60.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107807601)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453315.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;