Transcript | Ll_transcript_503244 |
---|---|
CDS coordinates | 218-652 (+) |
Peptide sequence | MKFHSYLEALRFDRIIFNFPHAGFHGKEGNSTMIEMHKNLVLGFFQNASCLLRFNGEVHVNHKTNAPFSHWNLEELAIQSFLTLIECAEFRKENYRGYNNKRGDGNRCDEPFPLGQCSTFKFIYNPRALGKRTRINDMTYRLQRN |
ORF Type | 3prime_partial |
Blastp | Heavy metal-associated isoprenylated plant protein 41 from Arabidopsis with 65.57% of identity |
---|---|
Blastx | Heavy metal-associated isoprenylated plant protein 41 from Arabidopsis with 64.33% of identity |
Eggnog | Domain of unknown function (DUF2431)(ENOG4111V12) |
Kegg | Link to kegg annotations (AT1G55790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447035.1) |
Pfam | Domain of unknown function (DUF2431) (PF10354.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer