Protein coding transcript 959

• Transcript: Ll_transcript_503245
• CDS coordinates: 305-739 (+)
• Peptide sequence: MKFHSYLEALRFDRIIFNFPHAGFHGKEGNSTMIEMHKNLVLGFFQNASCLLRFNGEVHVNHKTNAPFSHWNLEELAIQSFLTLIECAEFRKENYRGYNNKRGDGNRCDEPFPLGQCSTFKFIYNPRALGKRTRINDMTYRLQRN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_503245

• Blastp: Heavy metal-associated isoprenylated plant protein 41 from Arabidopsis with 65.57% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 41 from Arabidopsis with 67.01% of identity
• Eggnog: Domain of unknown function (DUF2431)(ENOG4111V12)
• Kegg: Link to kegg annotations (AT1G55790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447035.1)
• Pfam: Domain of unknown function (DUF2431) (PF10354.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;